PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010103945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 367aa    MW: 41799.6 Da    PI: 6.4749
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010103945.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++ ++++G g+W++ ++  g++R++k+c++rw +yl
   XP_010103945.1 14 KGPWTPEEDEKLIQHIQKHGFGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.36.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
   XP_010103945.1  67 RGKFSQDEEQTILHLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-25664IPR009057Homeodomain-like
PROSITE profilePS5129419.411961IPR017930Myb domain
SuperFamilySSF466897.55E-3211108IPR009057Homeodomain-like
SMARTSM007172.3E-161363IPR001005SANT/Myb domain
PfamPF002496.3E-181461IPR001005SANT/Myb domain
CDDcd001672.28E-131661No hitNo description
PROSITE profilePS5129426.68862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2765117IPR009057Homeodomain-like
SMARTSM007173.7E-1666114IPR001005SANT/Myb domain
PfamPF002498.4E-1667112IPR001005SANT/Myb domain
CDDcd001675.81E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MDSSPSCEEN GLKKGPWTPE EDEKLIQHIQ KHGFGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQDEEQTILH LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRI DLFSSLPHLM ALANFKDHLL KHHPLMDLQL LQSLLLQSSY VQQIENDVVA  180
DHDHVDNPFS NLMSQVLVGN PSLFSHHHEN YYYDNTSTTS PQPLHQYPAL LSHLDPQKVP  240
LSFQPSLNSD HHEHDQNIMG QQLGNSESFT TNMVSNDLQG DYPPDHDHHD HDSSSTWFIP  300
PLSPSNILPN LTHHEALMCN NIIIPGDSTS ITSTMSSYGR PSSSTTTNYI SHSPTELFLD  360
DPTMHYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2295601e-131KP229560.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB04) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010103945.10.0Transcription factor
TrEMBLW9RXX30.0W9RXX3_9R
STRINGPOPTR_0005s17080.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.14e-92myb domain protein 93